PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P05000_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 186aa    MW: 21388.2 Da    PI: 8.8623
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P05000_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.66.8e-1657111256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++++eq   Le+ F+++  +  + ++eLA++l++++rqV vWFqNr+a+ k
  GSMUA_Achr7P05000_001  57 RKKLRLSQEQQALLEDSFREHTFLAPKLKQELASRLNIQQRQVEVWFQNRKARNK 111
                            778899***********************************************98 PP

2HD-ZIP_I/II95.74.8e-3157145189
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rls+eq +lLE+sF+e++ L p+ K+ela++L++q+rqv+vWFqnr+AR k+kq+E + e+Lk+  ++l+een+rL++eveeLr
  GSMUA_Achr7P05000_001  57 RKKLRLSQEQQALLEDSFREHTFLAPKLKQELASRLNIQQRQVEVWFQNRKARNKLKQTEAELETLKKYRERLSEENRRLKREVEELR 144
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 e 89 
                            +
  GSMUA_Achr7P05000_001 145 S 145
                            6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.38E-1551114IPR009057Homeodomain-like
PROSITE profilePS5007116.24453113IPR001356Homeobox domain
SMARTSM003898.2E-1355117IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-1456118IPR009057Homeodomain-like
PfamPF000463.0E-1357111IPR001356Homeobox domain
CDDcd000865.86E-1257114No hitNo description
PROSITE patternPS00027088111IPR017970Homeobox, conserved site
SMARTSM003406.8E-9113157IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MEGEECDTSL TLSVGGDCAG GLVSTQFHAL FPFHHHHQQE EEEEDCSRKT IIAGGTRKKL  60
RLSQEQQALL EDSFREHTFL APKLKQELAS RLNIQQRQVE VWFQNRKARN KLKQTEAELE  120
TLKKYRERLS EENRRLKREV EELRSTRRLG SPEPMATTLT ICPACLRKTS CRARPQRQGG  180
TNGVST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15561TRKKLRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408056.11e-134PREDICTED: homeobox-leucine zipper protein HAT14-like
SwissprotP466655e-40HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLM0TEU01e-134M0TEU0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P05000_0011e-134(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-41homeobox from Arabidopsis thaliana